Dataset for protein Bim of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                *****************************************       
--------------------------------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ-------
mplsvrsylwiwlgspgaglgdlapirrkkdq                                         gnpegeg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 *******************************
-------------------------------------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
drcpqgspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdt                               

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
*******************************************************************
SMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
                                                                   
© 1998-2019