Dataset for protein Bad of organism Astyanax mexicanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .:*  * *.  *:. .*:: ::.**.  :.*. ** .*
----------------------------------------pgrvRlySvSrvyNisrwEenlqqsGAsrhegGvrDGdsF
mdhmftisdesdaseelgdsdqpevsktaepsrsgqhitvgekl ge e qqr fnmn ddened  gaedd ag  ap 

        90       100       110       120       130       140       150     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
* **.***.:** *********.******. *::*  * *::*..*  :.. .**:***. **.:.         
RrRSrSAPpsLWkAKKYGRQLRrMSDEFDtwLeqGmlR-RttGpgR--qtsrsWFsFLWstKEsesre-------
 g  q   aa  a         k      kg dk dk v sa aa qmhnnpg  a   gh  edgeasssrpae
© 1998-2018