Dataset for protein classical BH3-containing proteins of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :.*.  ..:  .::  * .    :.  ..* *:*..*   . .  .   ..*: : .: .:* 
mddeeddvfepkancwrttFreikcehrgtqtpGpalvpnngmlpcGvAeEprPlfygnagfrlhfpaRfelvgdhraSr
---------------maan kisdsdseaseev eg----enqqsa q q sk qtlslpvtkttaag lrvnsesht s
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .  *              : :.: * ... *.*  .    *.:*. :.*:*    :. :: : .. :    *       
qgstE--------------qqnsmeRlprqrPaArsveaciGqkLqligDqFh--werlql-kvsrrqt--tWw------
iard elmargedevctptegdpfr rsksa p lwaakky rq rrms e dslldkgemyhrnqlnqspm lsylfsy
                                                             v akkihhgkc  etaeah

       170       180       190    
....:....|....:....|....:....|....
         : .                      
----rvnnsvltvwqrrg-----f----------
qtteklhhhlislnkptelsqwq-ltvnggggrr
aepcgeaaaienhlfd        iagg      
© 1998-2019