Dataset for protein Bmf of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************* : .. :    *           .:  :::::   
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLykrsrrqt--mWw----------rvhhsvltvwkp
                                             vhanqinqgpc letaeayatpcklaaaiisllfd

       170        
....:....|....:...
**     *:: .      
RG-----Fltvn------
  lsqwq iaggggggrr
© 1998-2019