Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdregrqlqpaerp------pqlrpg--------------ap-tslqtepqgnpegnhgg---
mfqipe--pseqedv-sae-glspstagd--pgsgkh------sllsadlfaqslldl-gdrshqqgl---------egd
 cpc lfe-e-----e---d----ced--hq      arqa                ctlsaaslstwptssshllrtys
      hrm-vrqc cdlsmdvll---sva        gtq                -qvptmrvfagthccmpg  pta
       msrgppl  aila tfk rvfs         wac                m alk ksv dvs qed   as 
        g    a       r g gs a                               k  ekl  sp   c      
                          q                                 a   a    d          
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------drspapmscdkstqtpsppcqafnhylsamas
scphgspqgplappaspgpfatrsplfifvrrssvlsrsssgyfsfdtspatstleleeaseglvlsapg----------
vetrsrs                                         glyqt-sqessprs----a-g-qgrvwplvvt
t esahh                                         nsverltwvrrnmpvvps-s-vtevqrrwsgr
q a                                             ekraqkrmrmqhldsrmgqptssstpqlvpyd
p                                                eq dg lpacgharmaa lrdrpnmmdelpi
                                                 an  d  a a   ee   flclaelk cglg
                                                  h  a        a    ea i d    fde
                                                  d                           cc
                                                                               a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mr---------------qsqaepa---gmr---pe-wia--l--i---f-------------------------------
--pyrlfyptsfpayly-------gqp---wgr--i---qe-rr-gde-nayyprrvflnnyqaaqdhphrvilrllryi
aalwfrplfsfrllvrvevaqptpalwqrwfreelqfygrkralssrltvdpfvqvrrrrpstsgehwvsmwssvytlvl
wegq   iaaaedksgplhsptsqwpllll  davyrsrewgtkqwevsqsltrgylsqwspsqststrmpqwwswnqlm
fv            q hvagvglevainvh   nrvqrqkvcsqmvkraprsqkdqiepprkl pgqsqnakrvqv ai 
et              aptvsyis  afig   kqtgpldr qglr q hngngcleakhqee h ara  aqalg  f 
ns               hgpmva    ahe   hkndg  l ncga m difheai     d     n      g     
ii               aeell      f    ghl a  i f      c   a                          
 d                  ga           dae             a                              
                    e                                                           

       250       
....:....|....:..
                 
-----------------
vrlvwrmhgrrpsappr
qlwwlprshnlnlmlsq
hs pfnnlegghglgkn
gn ldmgg  age e e
a  aa fe         
                 
                 
                 
                 
© 1998-2019