Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdregrqlqpaerp------pqlrpg--------------ap-tslqtepqgnp---hggegd
mfqipe--pseqedv-sae-gvspstagd--pgsgkh-rqa--sllsadlfaqslldlqgdashlqgl---egn------
 spvrpfe-------e---d-l---e---        m---g               cdlsrarqsawptssshmentys
 cec llsmeipqctlllsqd-fkc-dss        agtq                s vpkessftved lec   vtc
      hrsrglpe ca  afrlg rv a         wvv                m  ke dkk   s       ssa
        gd  ma        h  gs           eac                        d           aph
                                                                              h 
                                                                              d 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
scphgspqg-------plappaspgpfa--s-------------rs-sg-f----drspapmscdkstqtpsppcqafnh
---------sqadkal------------tr-plfifvrrssvls--s--y-sfdtetpq---alwralsygrfr-rkqeq
cetrlrssadpekvstqtlslvqvsqgvgygrvla mlprtgvtevlvvtyyatas---rvv-gpp-qalrgwvpgglwe
vvlgsqrttylsgtqedasvesmsysvtmseng   imlpgdtgkpqrrlwvvsp-pqsvtlw-gav--- evlwlrerv
tmgsplhpsnamerm ssrragllaeerdq        dcc iedlpqpivgphgylleliirv--tsrs argtkqwqt
qgeqahcnl   aqh rkpm ee   al                 eeplf enf pfk ddanrrglrpr  qesemspr
p cp a ie    le eegh  a                          c a a nah  a efech gq  kcrdegdl
l a                                                      a           a  eaf   af
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ylsamasmr-----------------------------------------------------------------------
wqaplgaa-klfcsglwllylrvrqsqaepagmrpeiwiaqelrrigdefnayyprrvflnnyqaaedhphmvilrllry
twrlf-lvsrwqalattfqrryrqehsqptsrvhwqmvlsswwtqlsqswwrrragpreppss                 
svpe-villqvmsiifqahlkhnlhevpgsnqtwtwyrsynsnmkvnpfprgnnlpemssepd                 
rrk-vrditlrargddn fge ghaqrvvrhlrssvvlqlllilgslg e dhg   lgka                   
lpiwiq--iam  f ah  d     phlnqe qahkrfpfehgaa i          i                      
hgds nrwe    d            e ki  p eaqaa  g               g                      
fa   kgqd                       l                                               
     defa                                                                       
     cce                                                                        

         
....:....
         
---------
ivrlvwrmh
         
         
         
         
         
         
         
         
© 1998-2018