Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdregrqlqpaerp------pqlrpgap-tslqtepqg-----hgg-----------------
mfqipe----------sae-glspstagd--pgsgkh-rqa--s-g---------npegn---egdscphgspqgplapp
      fepseqedve---d----cedfvkacsa rlrgtqspllldashqqglptssshl  tysvetrsrs       
       mmevrqcmcplpmdvfr-pv sh       g---qa-q ltmrvvagsd  ed   asat esahh       
        s   pl  dillhtllgmq kc       awss       aelk              p a           
                     rgk g            lrc                                       
                                      ka                                        
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------r------------drspapmscdkstq---tpsppcqafnhylsamasmr-------
aspgpfatrsplfifvrrssvls-sssgyfsfdqmtspglrtteqeeastqtlslvsss-gvm----------rlfygsa
       lsad  aqslldcpvp lqlfplthc  cgsyqsllwlsdkae   --a--at---rpcgvtveaqlw rfnf
                    q   a  stwvp    nlvedksqvrrnrs   vr-lq-rdsslvwpwvgrwa    ai 
                                    eeqa grmrmqhmp   rmpgappcrptqrllsedpv       
                                     an  d le cgld   ge a ll qlnlmdepptft       
                                      h  a  a a ha   e    fg lgd k  lliis       
                                      d              a    ea ie      dcei       
                                      a                      aa      ca e       
                                                                        d       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------qsqaepa---g-r-e-w----lrrig----------------------------------------------
tyrlryva-------wlv-m-p-i-iaqe-----defnayyprrvrlnnyqaaqdrphmwilrllryivrlvwrmhgrrp
gpkspvpyevplvapvgsqlpevqrygrwraqssrklqdpfkqvrfrrpstssehhvsrvssvytlvlqlwwlprshnln
effdlqlhghavttqpplarwgrygsrevgvkqwevtvnsqrllnsqhvqsqggtwqmvqwvswnqlmhs pfnnleggh
    alg ststgsel irqlnltfrldretlmv rspirnggyllpwsplhqtstnrpkrqlg ai gn ldmgg  ag
        ppvsyl g enphhkldqh kcsglr madflaediieksrlfcp nseqeaqag   f a  aa fe    
        hg qqi   aligdhe p  i f ga l aci dcfhaipqke   a a a                     
        af pl     fgeag  a  a   f      f aa e   ke                              
         e ma         f                          d                              
           e          a                                                         

     
....:
     
-----
sarpr
lmpsq
gllkn
egg e
  e  
     
     
     
     
© 1998-2019