Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                *... *     *  :.
mdppgyldddfstldgleddvfhaedcglasqpsemtfpgiftqsksyncllgrfqlfplmhcc pgqp aclld alnt

        90       100       110       120       130       140       150       160
*...: : . :*            * :. :*        : ...:*. *   *:::..*:.**.:*. *.*:*:  *  *
 nanafaidcf pcgvteepqrlf gdagw lhgrpiceaenphf ee qei edlqp iq  qe qc a e hal cp 

       170       180       190       200       210       220  
.             **   *:* :                     : : :   : **     
hgqnrnqvwwqiff  dnq l heanrhragrsctttyfpfteppicfpflemip  cleai
© 1998-2019