Dataset for protein classical BH3-containing proteins of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         *.        :      .  : .   . : :        
-------------------------------maarftisdsDsdpsegmepeghnqsppgqeqqvfprhtlt--------
mdprqpnrsdgstavtatgesggdpppvgaa---------n ggerrvgredssgwrttfsqsrcrtksssspgpalpqn
                               gvstp srsm de ddff   p cgge er ik qd g q         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *   ... :     :: .       :  .   :  .                : .      .  .  
------------lPelrasgrirlnseshastvyrdeevqakadeeagtpt--------------dgapfrarsksappa
sgmlpvgvsvfrr rrysnayfsyhfpaqpesp-sprpltqqrstqtqsgmgqvmnhalqrlaeanisd-----rqqslm
ndg gcfraeep  lfsg  g   d d  f l lg l  rfdda  epn                e p l thqqhg dl

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   *.:*. :.*:*     :   *: .                        **         . 
lwaakk------------yGqqLrrmsDeFdslllkgemRkvrsagtarqmhhsksww-------syLFshqetegennh
ssvstqqqnaagdmqavev rk qlig q nrhhdqvyh nrwvqiqp--------dptvllcvlll  vrgriiysqgs
q seac            i  e      d hne  elag hq ng plirlp ihq  rlaaamg    di l a gg a

         
....:....
         
heshthrte
trr------
gn eg shv
© 1998-2019