Dataset for protein classical BH3-containing proteins of organism Amphilophus citrinellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :: *       ** :*       ::.::*. *.                               :.********
------lvlF------sPFrqGsgqqpvsvlsliWstPr-------------------------------svSRDEELVV
mpepprfih dveegql  ie rflllshliqff gl khsqaighdqntspmrhptarrirmnseshtsaf        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RGEDEICTPTEGDPFRRRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGMKKAKNAGTTRKMHHSKTWWSYLFSHQESD
                                                                                

       170    
....:....|....
**************
GENSHHENHTQRTE
              
© 1998-2019