Dataset for protein Unclassified of organism all

[Download (right click)]

11 sequence(s)

>gnl|bcl2dbpro|A0A0E3T8T5_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus (length=177 residues).
MIGDRHRDDTDIDASAVVAAYLASEYANAVIDNLSDSERVALEALRASGDEVRHPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQSARQRMSRVAGLGM
FLAGCGILFAGARFLRR
>gnl|bcl2dbpro|A0A0E3XB25_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus (length=177 residues).
MIDDRHRDDTDIDASAVVAAYLASEYANAVIGNLSDAERVALEALRASGDEVRYPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQAMRHRMSRVAGLGM
FLAGCGILFVGARFLRR
>gnl|bcl2dbpro|Q6VZT9_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Canarypox virus (length=175 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRV
AAFIITSLAVINLFL
>gnl|bcl2dbpro|A0A2H4X256_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Flamingopox virus FGPVKD09 (length=175 residues).
MASSTMKDETYYIALNMIQNYIIEYSTDKSRKDFVIDSVSYDILKAACEMVIKNNYNEFDKFISKNIDFNAIITQAIEDK
INWGRIITIIAFCAYYSKKVKQDTSSSYYDELISETITDAILSRYRSWFIKQDYWNGIHIYKNYTYIFNTATYCVFTASL
VIASLAVFKICSFYI
>gnl|bcl2dbpro|A0A0A7MEW5_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Parapoxvirus red deer/HL953 (length=172 residues).
MAGEHNVDSSAVMAAYLAREYAYAIESQLSAAERRALEALRGACAEVRFPLSRELVAAGSAYAAPEADHVPSALVAALLE
TPASPGRIVTATELCAQMGRIWTRGARVLGFLRLLCVLADRMPATADQDLGGWLVRVAQVRAARRRVTRLAGIGVVLAGC
GIVVLGARMLRR
>gnl|bcl2dbpro|A0A068EHE4_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Penguinpox virus (length=175 residues).
MASSTMKDETYYIALNMIQNYIIEYSTDKPRKDFVIDSVSYDILKTACEMVIKNKYNEFDKFISKNIDFNAIITQAIEDK
INWGRIITIIAFCAYYSKKFNQDTPSSYYDEIISETITDAILSRHRSWFIKQDYWNGIHIYKNYTYIFNKATYCIFTASL
VISSLAVFKICSFYI
>gnl|bcl2dbpro|A0A068EE18_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Pigeonpox virus (length=175 residues).
MASSTMKDETYYIALNMIQNYIIEYRTDKPRRDFVIDSASYDILKTACEMVIKNNYNEFDKFISKNIDFNAIITQAIEDK
INWGRIITIIAFCAYYSKKVKQDTSSSYHDELISETITDSILSRYRSWFIKQDYWNGIHIYKHYMYIFNTATYCIFTASL
VIASLAVFKICSFYI
>gnl|bcl2dbpro|A0A1Z3GCP4_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Seal parapoxvirus (length=174 residues).
MANRNNSIDTGAVMAAYLASEYAAAVEANLTLQERAALEALRVSAAEVRSPLLFELANAGDNFVQPENSHVPAALISALL
EAPTSPGRVVTATELCAQMGRRWVRGRRFLDFMRLVHVFVDRMPPSASEDIGRWLCNAARARAARRRVVRTAGLSVIAAG
CAAVALGVWLLRRR
>gnl|bcl2dbpro|A0A1V0QG20_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Shearwaterpox virus (length=180 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRA
AAFIITSLAVINLFFVESHN
>gnl|bcl2dbpro|A0A1V0S7R2_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Shearwaterpox virus (length=174 residues).
MEMQKDETYYTVLDIIQNYFIEYLTNKNRQDFVADERAYVIIKDMCNRIIKRDIELLMKDVKYDNLEDKIPKIVNDTIGD
KITWGRIASVIAFGAYSTNIFKKEGKDDLVDNMPDTITGLILDICRDWMVEQDCWNGFYNSILLKEKFGYIISCTRIAAF
VITSLAIANLFIKI
>gnl|bcl2dbpro|A0A0M3ZJZ2_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Turkeypox virus (length=182 residues).
MDSTRVVIKDESYYILLDIIQNYLEEYSTGCDRINFVHNESAYTMLNRICSSVITTNKTTFDEIIDKYDIEEIIKDIYLT
LYNSLNWGQIIASVSFGAYLSKVIVEKYPNDTDYVRRVSETITEAILANDKDWFTNQGYWKGIFKFDMLTELFKITKYTL
CSASVIITCMASMKILSSFFKI
© 1998-2018