Dataset for protein ORFV125 of organism all

[Download (right click)] [Alignment] [Repertoires]

17 sequence(s)

>gnl|bcl2dbpro|Q6TV64_ORFV125-01 ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus GN=ORFV125 (length=177 residues).
MIGDRHRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEALRASGDEVRHPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATRHRMSRVAGLGM
FLAGCGILFVGARFLRR
>gnl|bcl2dbpro|A0A0F6N236_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRKLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8HLA0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8HV90_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8I4U2_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A1D8RAA0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A2Z2Q5R8_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAHLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A2Z2Q7G3_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRTLGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A2Z2Q9B0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRVVTAVGLCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A2Z2QAK0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRPPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|F1AXH8_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAVAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRLWTRGHKLVDFMRLVYVLLNRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q6TVJ5_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGEEVRSPLLQELSNAGEHRTNPENSHIPAALVSALLE
TPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q6TVX5_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRRLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q80G30_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRQLVEFMRLVYVLLDRLPPTADEDLSTWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|W6EVU4_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|D3IZD7_ORFV125-01 ORFV125 protein OS=[Viruses] Pseudocowpox virus GN=ORFV125 (length=173 residues).
MANRNEIDSSAVVAAYLAGQYAAAVEEQLTPREREALEALRISGDEVRSPLLQELSNAGDYRANPESSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLIDFVRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV
GLLFLGVRVLRRT
>gnl|bcl2dbpro|D3IZF4_ORFV125-01 ORFV125 protein OS=[Viruses] Pseudocowpox virus GN=ORFV125 (length=173 residues).
MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGDEVRSPLLRELSNAGDYRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV
GLLFLGVRVLRRT
© 1998-2018