Dataset for protein Unclassified of organism Turkeypox virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0M3ZJZ2_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Turkeypox virus (length=182 residues).
MDSTRVVIKDESYYILLDIIQNYLEEYSTGCDRINFVHNESAYTMLNRICSSVITTNKTTFDEIIDKYDIEEIIKDIYLT
LYNSLNWGQIIASVSFGAYLSKVIVEKYPNDTDYVRRVSETITEAILANDKDWFTNQGYWKGIFKFDMLTELFKITKYTL
CSASVIITCMASMKILSSFFKI
© 1998-2018