Dataset for protein Unclassified of organism Shearwaterpox virus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A1V0QG20_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Shearwaterpox virus (length=180 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRA
AAFIITSLAVINLFFVESHN
>gnl|bcl2dbpro|A0A1V0S7R2_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Shearwaterpox virus (length=174 residues).
MEMQKDETYYTVLDIIQNYFIEYLTNKNRQDFVADERAYVIIKDMCNRIIKRDIELLMKDVKYDNLEDKIPKIVNDTIGD
KITWGRIASVIAFGAYSTNIFKKEGKDDLVDNMPDTITGLILDICRDWMVEQDCWNGFYNSILLKEKFGYIISCTRIAAF
VITSLAIANLFIKI
© 1998-2018