Dataset for protein Unclassified of organism Seal parapoxvirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1Z3GCP4_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Seal parapoxvirus (length=174 residues).
MANRNNSIDTGAVMAAYLASEYAAAVEANLTLQERAALEALRVSAAEVRSPLLFELANAGDNFVQPENSHVPAALISALL
EAPTSPGRVVTATELCAQMGRRWVRGRRFLDFMRLVHVFVDRMPPSASEDIGRWLCNAARARAARRRVVRTAGLSVIAAG
CAAVALGVWLLRRR
© 1998-2018