Dataset for protein ORFV125 of organism Pseudocowpox virus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|D3IZD7_ORFV125-01 ORFV125 protein OS=[Viruses] Pseudocowpox virus GN=ORFV125 (length=173 residues).
MANRNEIDSSAVVAAYLAGQYAAAVEEQLTPREREALEALRISGDEVRSPLLQELSNAGDYRANPESSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLIDFVRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV
GLLFLGVRVLRRT
>gnl|bcl2dbpro|D3IZF4_ORFV125-01 ORFV125 protein OS=[Viruses] Pseudocowpox virus GN=ORFV125 (length=173 residues).
MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGDEVRSPLLRELSNAGDYRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRSIGVGTVMAGV
GLLFLGVRVLRRT
© 1998-2018