Dataset for protein Unclassified of organism Penguinpox virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A068EHE4_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Penguinpox virus (length=175 residues).
MASSTMKDETYYIALNMIQNYIIEYSTDKPRKDFVIDSVSYDILKTACEMVIKNKYNEFDKFISKNIDFNAIITQAIEDK
INWGRIITIIAFCAYYSKKFNQDTPSSYYDEIISETITDAILSRHRSWFIKQDYWNGIHIYKNYTYIFNKATYCIFTASL
VISSLAVFKICSFYI
© 1998-2018