Dataset for protein Unclassified of organism Parapoxvirus red deer HL953

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0A7MEW5_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Parapoxvirus red deer/HL953 (length=172 residues).
MAGEHNVDSSAVMAAYLAREYAYAIESQLSAAERRALEALRGACAEVRFPLSRELVAAGSAYAAPEADHVPSALVAALLE
TPASPGRIVTATELCAQMGRIWTRGARVLGFLRLLCVLADRMPATADQDLGGWLVRVAQVRAARRRVTRLAGIGVVLAGC
GIVVLGARMLRR
© 1998-2018