Dataset for protein poxviridae of organism Orf virus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A0F6N236_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRKLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8HLA0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRRLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8HV90_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A0R8I4U2_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|A0A1D8RAA0_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|F1AXH8_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAVAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRLWTRGHKLVDFMRLVYVLLNRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q6TVJ5_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGEEVRSPLLQELSNAGEHRTNPENSHIPAALVSALLE
TPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRALGVGAVVAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q6TVX5_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRRLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|Q80G30_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAIELCAQMGRVWTRGRQLVEFMRLVYVLLDRLPPTADEDLSTWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
>gnl|bcl2dbpro|W6EVU4_ORFV125-01 ORFV125 protein OS=[Viruses] Orf virus GN=ORFV125 (length=173 residues).
MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQELSNAGEHRANPENSHIPAALVSALLE
APTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRVLGVGAVMAGV
GMLLLGVRVLRRT
© 1998-2018