Dataset for protein Unclassified of organism Fowlpox virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G3CB29_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Fowlpox virus (length=181 residues).
MDTDVNSRKDETYYIILNIIQNYFIEYYSGKSRQCFVEDQRAYTIVKDTCELIIKKYFIDLQKIVAKYNSDIGSKFPEIV
SNTIQDKITWGRIMSIIAFGAYITKVFKEQGNDDLVYRMPDIVTESLLIKCRTWIISQDYWNGLHKYVSDHEKFSYLTYS
IKAAAFIITSLAIANFFYKYI
© 1998-2019