Dataset for protein FPV039 of organism Fowlpox virus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q70HB1_FPV039-01 FPV039 protein OS=[Viruses] Fowlpox virus GN=FPV039 (length=175 residues).
MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDK
INWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNTASYCIFTASL
IIASLAVFKICSFYM
>gnl|bcl2dbpro|Q9J5G4_FPV039-01 FPV039 protein OS=[Viruses] Fowlpox virus GN=FPV039 (length=175 residues).
MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDK
INWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNTASYCIFTASL
IIASLAVFKICSFYM
© 1998-2018