Dataset for protein Unclassified of organism Flamingopox virus FGPVKD09

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2H4X256_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Flamingopox virus FGPVKD09 (length=175 residues).
MASSTMKDETYYIALNMIQNYIIEYSTDKSRKDFVIDSVSYDILKAACEMVIKNNYNEFDKFISKNIDFNAIITQAIEDK
INWGRIITIIAFCAYYSKKVKQDTSSSYYDELISETITDAILSRYRSWFIKQDYWNGIHIYKNYTYIFNTATYCVFTASL
VIASLAVFKICSFYI
© 1998-2018