Dataset for protein Unclassified of organism Canarypox virus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A2S1GHL1_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Canarypox virus (length=175 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRV
AAFIITSLAVINLFL
>gnl|bcl2dbpro|Q6VZT9_uncFPV039-01 Putative FPV039 protein OS=[Viruses] Canarypox virus (length=175 residues).
MDPSVKKDEIYYTILNIIQNYFIEYCTGKNRNFHVEDENTYIIVKNMCDIILRDNIVEFRKDIDRCSDIENEIPEIVYDT
IHDKITWGRVISIIAFGAYVTKVFKEKGRDNVVDLMPDIITESLLSRCRSWLSDQNCWDGLKAYVYNNKKFYYVTRYFRV
AAFIITSLAVINLFL
© 1998-2019