Dataset for protein Unclassified of organism Bovine papular stomatitis virus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A0E3T8T5_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus (length=177 residues).
MIGDRHRDDTDIDASAVVAAYLASEYANAVIDNLSDSERVALEALRASGDEVRHPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQSARQRMSRVAGLGM
FLAGCGILFAGARFLRR
>gnl|bcl2dbpro|A0A0E3XB25_uncORFV125-01 Putative ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus (length=177 residues).
MIDDRHRDDTDIDASAVVAAYLASEYANAVIGNLSDAERVALEALRASGDEVRYPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQAMRHRMSRVAGLGM
FLAGCGILFVGARFLRR
© 1998-2018