Dataset for protein poxviridae of organism Bovine papular stomatitis virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q6TV64_ORFV125-01 ORFV125 protein OS=[Viruses] Bovine papular stomatitis virus GN=ORFV125 (length=177 residues).
MIGDRHRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEALRASGDEVRHPMLQELTNAGGNHANPETSHIPATLI
SALLEAPASPGRMVTAIELCAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATRHRMSRVAGLGM
FLAGCGILFVGARFLRR
© 1998-2018