Dataset for protein Unclassified of organism all

[Download (right click)]

6 sequence(s)

>gnl|bcl2dbpro|A0A1B2IU77_unc097R-01 Putative 097R protein OS=[Viruses] Cod iridovirus (length=148 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRT
FPSSMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
>gnl|bcl2dbpro|A0A0D3R3H7_unc097R-01 Putative 097R protein OS=[Viruses] German gecko ranavirus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGAIAGVIAGVIAGVVLSLLFS
>gnl|bcl2dbpro|A0A1B2RW88_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus Sa (length=178 residues).
MYISAPMSDKLEIDTKKLIDSIFNNSVENEDETLKVMKREINLLFDKHRRVYSNMIDEISSSKLGISAVMEDTIKKVFSD
GSINWGRIVSLITFGVLVADYLKTNDGEHEIVAVKDSISSYLINHQKEWLLKNNAWKGFVDFFQVTSNLPSIKSSLTVFI
ALISFGAVLYSFFNLTTF
>gnl|bcl2dbpro|A0A286P9S2_unc070L-01 Putative 070L protein OS=[Eukaryota] Oryzias latipes (length=152 residues).
MDEEIRILIKGVLGHFVGRRQDFEVERPRCREAVNAMTRAVCEVLEVHRPKYTEMVSDLGDSFPDAAMVNVAKSLFEDGI
INWGRVVSLICLGAAVCQHQDRFSGSPGSLLADTVSEAIASYLLTEHRGWLEEMCWVSGLYSRGLNFMLSLL
>gnl|bcl2dbpro|A0A1B2IUH3_unc097R-01 Putative 097R protein OS=[Viruses] Ranavirus maximus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
>gnl|bcl2dbpro|A0A192GNS8_unc097R-01 Putative 097R protein OS=[Viruses] Short-finned eel ranavirus (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHVSLLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEAALTKFIQDPEIDENLREWTDRLGTVRAIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018