Dataset for protein ORF115R of organism all

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q5GAF0_ORF115R-01 ORF115R protein OS=[Viruses] Grouper iridovirus GN=ORF115R (length=152 residues).
MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKS
ESESERTQITEQLERFFRQDAISNWIASNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYLLP
>gnl|bcl2dbpro|Q5YFF0_ORF115R-01 ORF115R protein OS=[Viruses] Singapore grouper iridovirus GN=ORF115R (length=152 residues).
MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKS
ESESERTQITEQLERFFRQDAISNWIVSNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYLLP
© 1998-2018