Dataset for protein 097R of organism all

[Download (right click)] [Alignment] [Repertoires]

27 sequence(s)

>gnl|bcl2dbpro|Q6YH32_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum stebbensi virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0U2QBA9_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGINLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0U2QHX4_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLLDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0U2R7T3_097R-01 097R protein OS=[Viruses] Ambystoma tigrinum virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVHASFLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|T2C510_097R-01 097R protein OS=[Viruses] Andrias davidianus ranavirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A192GQ13_097R-01 097R protein OS=[Viruses] Bohle iridovirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGAIAGVIAGVVLSLLFS
>gnl|bcl2dbpro|V5N073_097R-01 097R protein OS=[Viruses] Chinese giant salamander iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0A0VDG1_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A2D0XKG8_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A2D0XMC5_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|H6WEE3_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRMAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|D3TTY2_097R-01 097R protein OS=[Viruses] Epizootic haematopoietic necrosis virus GN=097R (length=137 residues).
MGVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGIVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIDEHLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|I2BFW4_097R-01 097R protein OS=[Viruses] European catfish virus GN=097R (length=146 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEDVHASLLGDGVVNWGRVAAFMHVCRYTVRTFPS
SMDRTEVALTKFIQDPRVDKHLREWTDRLGTVGVIGRCLEWLEREWLGVGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A220IH18_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|Q6GZM8_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGLIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|W8TMV3_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|A0A222NTN8_097R-01 097R protein OS=[Viruses] Pelophylax esculentus virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A1B2ITU5_097R-01 097R protein OS=[Viruses] Pike perch iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A223PJ87_097R-01 097R protein OS=[Viruses] Rana catesbeiana virus 2 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|A0A223PJJ8_097R-01 097R protein OS=[Viruses] Rana catesbeiana virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACTHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A222NTZ1_097R-01 097R protein OS=[Viruses] Rana esculenta virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|H9XFR8_097R-01 097R protein OS=[Viruses] Rana grylio iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVSLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|A0A2P1GJP0_097R-01 097R protein OS=[Viruses] Rana nigromaculata ranavirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|Q2WEP2_097R-01 097R protein OS=[Viruses] Rana tigrina ranavirus GN=097R (length=149 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVITGVILSLLFS
>gnl|bcl2dbpro|C3RWV2_097R-01 097R protein OS=[Viruses] Soft-shelled turtle iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|A0A0D3R3S5_097R-01 097R protein OS=[Viruses] Testudo hermanni ranavirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A0D3R3I2_097R-01 097R protein OS=[Viruses] Tortoise ranavirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGIDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGVGVITGVVLSLLFS
© 1998-2018