Dataset for protein 097R of organism Zoo ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q8UH03_097R-01 097R protein OS=[Viruses] Zoo ranavirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYIVRIFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGAIAGVIAGVVLSLLFS
© 1998-2019