Dataset for protein 097R of organism Testudo hermanni ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D3R3S5_097R-01 097R protein OS=[Viruses] Testudo hermanni ranavirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
© 1998-2018