Dataset for protein 097R of organism Soft shelled turtle iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C3RWV2_097R-01 097R protein OS=[Viruses] Soft-shelled turtle iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
© 1998-2018