Dataset for protein ORF115R of organism Singapore grouper iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q5YFF0_ORF115R-01 ORF115R protein OS=[Viruses] Singapore grouper iridovirus GN=ORF115R (length=152 residues).
MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILEIGNNIVSDGNLNWGRILILLGISQLYFTKS
ESESERTQITEQLERFFRQDAISNWIVSNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYLLP
© 1998-2018