Dataset for protein Unclassified of organism Short finned eel ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A192GNS8_unc097R-01 Putative 097R protein OS=[Viruses] Short-finned eel ranavirus (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHVSLLGDGVVNWGRVAAFMHICRYTVRTFPS
SMDRTEAALTKFIQDPEIDENLREWTDRLGTVRAIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018