Dataset for protein Unclassified of organism Ranavirus maximus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1B2IUH3_unc097R-01 Putative 097R protein OS=[Viruses] Ranavirus maximus (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
© 1998-2018