Dataset for protein 097R of organism Rana tigrina ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q2WEP2_097R-01 097R protein OS=[Viruses] Rana tigrina ranavirus GN=097R (length=149 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVHASLLRDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGKCLEWLGAGVITGVITGVITGVITGVILSLLFS
© 1998-2018