Dataset for protein 097R of organism Rana grylio iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H9XFR8_097R-01 097R protein OS=[Viruses] Rana grylio iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVSLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
© 1998-2018