Dataset for protein 097R of organism Pike perch iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1B2ITU5_097R-01 097R protein OS=[Viruses] Pike perch iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018