Dataset for protein iridoviridae of organism Pelophylax esculentus virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A222NTN8_097R-01 097R protein OS=[Viruses] Pelophylax esculentus virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
© 1998-2018