Dataset for protein Unclassified of organism Oryzias latipes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A286P9S2_unc070L-01 Putative 070L protein OS=[Eukaryota] Oryzias latipes (length=152 residues).
MDEEIRILIKGVLGHFVGRRQDFEVERPRCREAVNAMTRAVCEVLEVHRPKYTEMVSDLGDSFPDAAMVNVAKSLFEDGI
INWGRVVSLICLGAAVCQHQDRFSGSPGSLLADTVSEAIASYLLTEHRGWLEEMCWVSGLYSRGLNFMLSLL
© 1998-2018