Dataset for protein Unclassified of organism Maylandia zebra

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P9D9X2_unc070L-01 Putative 070L protein OS=[Eukaryota] Maylandia zebra (length=162 residues).
MLSLQTTAAEVPMVTRVARTLFSDGIINWGRIVSLVAYGTVLLQASKSTLGPECAYAIGVSIAAYITDNHMDWLAGTDGW
VGWLRSIRLVLGLWMLWKNKQTPPTQSILSADSEHFVSRGVVGKPCQPSAKSSPTGNPYRMRAQNLPDLEHSPTQRTVAE
CS
© 1998-2019