Dataset for protein iridoviridae of organism Lymphocystis disease virus isolate China

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q677S5_070L-01 070L protein OS=[Viruses] Lymphocystis disease virus - isolate China GN=070L (length=174 residues).
MMSNKFETDTKYLIDAFFKEYFNSQESNDIILKTIKKEVNILFDKHRLVYSNMINDISITTEIDILVKKTAESIFSDGLV
NWGRIISLITFGILIVEYLKTINNTDKITSVSTIISSYLIEHQKHWLIKNNAWIGLVDFFTVQTYTSPVKSLLTFFIVFM
GTGAMLYSAFNLTY
© 1998-2018