Dataset for protein Unclassified of organism Lymphocystis disease virus Sa

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1B2RW88_unc070L-01 Putative 070L protein OS=[Viruses] Lymphocystis disease virus Sa (length=178 residues).
MYISAPMSDKLEIDTKKLIDSIFNNSVENEDETLKVMKREINLLFDKHRRVYSNMIDEISSSKLGISAVMEDTIKKVFSD
GSINWGRIVSLITFGVLVADYLKTNDGEHEIVAVKDSISSYLINHQKEWLLKNNAWKGFVDFFQVTSNLPSIKSSLTVFI
ALISFGAVLYSFFNLTTF
© 1998-2018