Dataset for protein 097R of organism Lumpfish ranavirus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q9T2R6_097R-01 097R protein OS=[Viruses] Lumpfish ranavirus GN=097R (length=147 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMHWEGVNLEEVHASLLGDGVVNWGRVAVFMHVCRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVVLSLLSLLSLLFS
>gnl|bcl2dbpro|A0A3Q9T8U5_097R-01 097R protein OS=[Viruses] Lumpfish ranavirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMQWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIYKHLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVVLSLLFS
© 1998-2019