Dataset for protein iridoviridae of organism Frog virus 3

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A220IH18_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
>gnl|bcl2dbpro|Q6GZM8_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGLIGRCLEWLGAGVITGVVLSLLFY
>gnl|bcl2dbpro|W8TMV3_097R-01 097R protein OS=[Viruses] Frog virus 3 GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
© 1998-2018