Dataset for protein 097R of organism European catfish virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I2BFW4_097R-01 097R protein OS=[Viruses] European catfish virus GN=097R (length=146 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEDVHASLLGDGVVNWGRVAAFMHVCRYTVRTFPS
SMDRTEVALTKFIQDPRVDKHLREWTDRLGTVGVIGRCLEWLEREWLGVGVITGVITGVVLSLLFS
© 1998-2018