Dataset for protein Unclassified of organism Esox lucius

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8X9F9_unc070L-01 Putative 070L protein OS=[Eukaryota] Esox lucius (length=154 residues).
NGSTNTTEEPVMCVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESKALSTMKQVATYPACLTGLHLDLLFKVCSTD
CSSQMDHKLGRVVSLLAFGTVVCRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLDGFVENVLLTFAGFGQRWPC
© 1998-2019