Dataset for protein iridoviridae of organism Epizootic haematopoietic necrosis virus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|D3TTY2_097R-01 097R protein OS=[Viruses] Epizootic haematopoietic necrosis virus GN=097R (length=137 residues).
MGVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGIVNWGRVAAFMHICRYTVRTFPS
SMDRTEVALTKFIQDPKIDEHLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018