Dataset for protein iridoviridae of organism Common midwife toad virus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A0A0VDG1_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=145 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A2D0XKG8_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|A0A2D0XMC5_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVITGVVLSLLFS
>gnl|bcl2dbpro|H6WEE3_097R-01 097R protein OS=[Viruses] Common midwife toad virus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRMAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018