Dataset for protein Unclassified of organism Cod iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1B2IU77_unc097R-01 Putative 097R protein OS=[Viruses] Cod iridovirus (length=148 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTLYTMQWEGVNLEEVHASLLGDGVVHWGRVAAFMHICRYTVRT
FPSSMDRTEVALTKFIQDPKIYKHLREWTDRLGTDRLGTVGVIGRCLEWLRAGVITGVVLSLLSLLFS
© 1998-2018