Dataset for protein 097R of organism Chinese giant salamander iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|V5N073_097R-01 097R protein OS=[Viruses] Chinese giant salamander iridovirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018