Dataset for protein iridoviridae of organism Bohle iridovirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A192GQ13_097R-01 097R protein OS=[Viruses] Bohle iridovirus GN=097R (length=141 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAVFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVGVIGRCLEWLGAGAIAGVIAGVVLSLLFS
© 1998-2018