Dataset for protein iridoviridae of organism Andrias davidianus ranavirus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|T2C510_097R-01 097R protein OS=[Viruses] Andrias davidianus ranavirus GN=097R (length=137 residues).
MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVHASLLGDGVVNWGRVAAFMHICRYIVRTFPS
SMDRTEVALTKFIQDPKIDKQLREWTDRLGTVRVIGRCLEWLGAGVITGVVLSLLFS
© 1998-2018